|
IDGAAM: A Framework for Link Based Biological Database Integration with Query Processing
The number of biological databases is increasing quite rapidly. The data available now is huge however the means to analyze this data require advancement. The highly diverse nature of biological data, different database formats and lack of common references among different databases are the current challenges in integration of these databases.
An application framework is required that can integrate desired databases as per researchers’ need. We developed a framework IDGAAM, and its application, gives privilege of integrating new databases at run time, to researchers. IDGAAM consists of global schemas of local databases with link based directed graph for query execution and optimization.
The query model supports nested queries as well, the inner query executes first and its output becomes input of the outer query. Nested query could be helpful when series of databases have to be accessed.
>Select <database name. database entity>[,]* where database.entity= = “ ”;
>Select <database name. database entity>* where database.entry == (Select <database name. database entity>* where database.entity= = “ ”)*;
>Select <function name> (“ASPREENVYMAKLAEQAERYEEMVEFMEKVVAAADGAEELTVEERNLLS”, <sequence>/<database.entity) from database name where database.id= = “ ”);
function -> GlobalAlignment | LocalAlignment | MoleculeVisualization
The information evaluated from these functions can be redirected to other statements. |
